PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676784470
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family NF-YB
Protein Properties Length: 380aa    MW: 41795 Da    PI: 8.3807
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676784470genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB185.54.1e-5820115297
      NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfedyveplk+yl+kyre+ege+
  676784470  20 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYVEPLKIYLQKYREVEGER 115
                89********************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.4E-5515126IPR009072Histone-fold
SuperFamilySSF471131.55E-4022124IPR009072Histone-fold
PfamPF008081.8E-272589IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006155.0E-215371No hitNo description
PROSITE patternPS0068505672IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006155.0E-217290No hitNo description
PRINTSPR006155.0E-2191109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MADSDNDSGG HKDGGNASTR EQDRFLPIAN VSRIMKKALP ANAKISKDAK ETVQECVSEF  60
ISFITGEASD KCQREKRKTI NGDDLLWAMT TLGFEDYVEP LKIYLQKYRE VEGERTTTGR  120
QGDKEGGGGG NGSSGGGGGG GGGGYNGGGA TTAGGGMYGG IVTMGHHHQG HVYGGGMHHT  180
QQIWENHIIR KKNMEQIRIR HVNLLSPYPA LTPLTRNGSS LDSQENTVCN LLQRIHQRLM  240
QEAFRLPSSC YFISSILLNV LTNETPQQTL ELSSLCRRYS LKNPRKKWKL SYVELTDLQP  300
HDIIDQILLR CIEKKRSQRS ESSASLELVA NPNEAMESKS ACIQHKPSNF NEIKAPGACY  360
KLFSPASIGY KESGHLSEYS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A2e-4518110193NF-YB
4awl_B1e-4518110294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A1e-4518110294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1892180.0AC189218.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB010F13, complete sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM25528229
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.14e-87nuclear factor Y, subunit B3